Skip to product information
1 of 1

Gene Bio Systems

Recombinant Malassezia globosa Assembly factor CBP4(CBP4)

Recombinant Malassezia globosa Assembly factor CBP4(CBP4)

SKU:CSB-CF427949MNH

Regular price $1,500.00 USD
Regular price Sale price $1,500.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) (Dandruff-associated fungus)

Uniprot NO.:A8PYF7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGGPANWARAITGGSVVIGFGYLLLKTATPNEQQLYDSLSPDLKRRVDAQRSSQADSER SAKVKEEQSKRLV

Protein Names:Recommended name: Assembly factor CBP4 Alternative name(s): Cytochrome b mRNA processing protein 4

Gene Names:Name:CBP4 ORF Names:MGL_1653

Expression Region:1-73

Sequence Info:full length protein

View full details