
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)
Uniprot NO.:Q2W027
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEASAAKFIGAGLAAIGMIGSGIGVGNIWANLIATVGRNPSAKANVELYGWIGFAVTEAI ALFALVVALMVLFA
Protein Names:Recommended name: ATP synthase subunit c Alternative name(s): ATP synthase F(0) sector subunit c F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein
Gene Names:Name:atpE Ordered Locus Names:amb3994
Expression Region:1-74
Sequence Info:full length protein
You may also like
-
Recombinant ATP synthase subunit c(atpE)
- Regular price
- $1,514.00 USD
- Sale price
- $1,514.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant ATP synthase subunit c(atpE)
- Regular price
- $1,511.00 USD
- Sale price
- $1,511.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant ATP synthase subunit c(atpE)
- Regular price
- $1,521.00 USD
- Sale price
- $1,521.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant ATP synthase subunit c(atpE)
- Regular price
- $1,506.00 USD
- Sale price
- $1,506.00 USD
- Regular price
-
- Unit price
- per
Sold out