Recombinant Magnaporthe oryzae  Vacuolar ATPase assembly integral membrane protein VMA21(VMA21)

Recombinant Magnaporthe oryzae Vacuolar ATPase assembly integral membrane protein VMA21(VMA21)

CSB-CF025866MPM
Regular price
$1,073.00 USD
Sale price
$1,073.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae)

Uniprot NO.:A4R0J5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MATRRIVATEKSILEKDDHIGSSPAAGEKSNITPAVPLDVILKLLAFTLAMVVIPIGSYF VTVNSIFKGNSTYAGALAAIMANVVLVAYVVVAMNEDQTEQEKAKEGKKDR

Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21

Gene Names:Name:VMA21 ORF Names:MGG_09929

Expression Region:1-111

Sequence Info:full length protein