Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae)
Uniprot NO.:A4R0J5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MATRRIVATEKSILEKDDHIGSSPAAGEKSNITPAVPLDVILKLLAFTLAMVVIPIGSYF VTVNSIFKGNSTYAGALAAIMANVVLVAYVVVAMNEDQTEQEKAKEGKKDR
Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21
Gene Names:Name:VMA21 ORF Names:MGG_09929
Expression Region:1-111
Sequence Info:full length protein