Recombinant Macaca mulatta Uncharacterized protein(IL17A)

Recombinant Macaca mulatta Uncharacterized protein(IL17A)

CSB-EP011597MOV
Regular price
$820.00 USD
Sale price
$820.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: F6T3G5

Gene Names: IL17A

Organism: Macaca mulatta (Rhesus macaque)

AA Sequence: GIAIPRNPGCPNSEDKTFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNADGNVDYHMNSVPIQQEILVLRREPRHCPNSFRLEKILVSVGCTCVTPIVHHVA

Expression Region: 24-155aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 42.1 kDa

Alternative Name(s):

Relevance:

Reference: Genome sequencing and comparison of two nonhuman primate animal models, the cynomolgus and Chinese rhesus macaques.Yan G., Zhang G., Fang X., Zhang Y., Li C., Ling F., Cooper D.N., Li Q., Li Y., van Gool A.J., Du H., Chen J., Chen R., Zhang P., Huang Z., Thompson J.R., Meng Y., Bai Y. , Wang J., Zhuo M., Wang T., Huang Y., Wei L., Li J., Wang Z., Hu H., Yang P., Le L., Stenson P.D., Li B., Liu X., Ball E.V., An N., Huang Q., Zhang Y., Fan W., Zhang X., Li Y., Wang W., Katze M.G., Su B., Nielsen R., Yang H., Wang J., Wang X., Wang J.Nat. Biotechnol. 29:1019-1023(2011)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.