Skip to product information
1 of 1

Gene Bio Systems

Recombinant Macaca fascicularis Zinc transporter ZIP9(SLC39A9)

Recombinant Macaca fascicularis Zinc transporter ZIP9(SLC39A9)

SKU:CSB-CF846491MOV

Regular price $1,910.00 USD
Regular price Sale price $1,910.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Uniprot NO.:Q95JP5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNMSTATTTHSCVPILVFPSYWASFSCCWWTRLVTPMCILLTPTQCEDDEDENLYDDPLL LNNPEAARSSNSKTTTTLGLVVHAAADGVALGAAASTSQTSVQLIVFVAIMLHKAPAAFG LVSFLMHAGLERNRIRKHLLVFSLAAPVMSMVTYLGLSKSSKEALSEVNATGMAMLFSAG TFLYVATVHVLPEVGGIGHSHKPDATGGRGLSRLEVAALVLGCLIPLILSVGHQH

Protein Names:Recommended name: Zinc transporter ZIP9 Alternative name(s): Solute carrier family 39 member 9 Zrt- and Irt-like protein 9 Short name= ZIP-9

Gene Names:Name:SLC39A9 Synonyms:ZIP9 ORF Names:QtsA-14752

Expression Region:1-235

Sequence Info:full length protein

View full details