Gene Bio Systems
Recombinant Macaca fascicularis Transmembrane protein 35(TMEM35)
Recombinant Macaca fascicularis Transmembrane protein 35(TMEM35)
SKU:CSB-CF023830MOV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Uniprot NO.:Q4R5F4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MASPRTVTIVALSVALGLFFVFMGTIKLTPRLSKDAYSEMKRAYKSYVRALPLLKKMGIN SILLRKSIGALEVACGIVMTLVPGRPKDVANFFLLLLVLAVLFFHQLVGDPLKRYAHALV FGILLTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS
Protein Names:Recommended name: Transmembrane protein 35
Gene Names:Name:TMEM35 ORF Names:QnpA-14372
Expression Region:1-167
Sequence Info:full length protein
