Recombinant Macaca fascicularis  NADH dehydrogenase [ubiquinone] 1 subunit C2(NDUFC2)

Recombinant Macaca fascicularis NADH dehydrogenase [ubiquinone] 1 subunit C2(NDUFC2)

CSB-CF837331MOV
Regular price
$1,102.00 USD
Sale price
$1,102.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Uniprot NO.:Q8SPI4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVPRRNPEPLRFLPDESRSLPPPKLTDPRLLYVGFLGYCAGLVDNFIHRRPIRSAGLHRH LLYITAFYFVGYYLVKRGDYTYAVRDREMFGYMKLHPEDFSEKEKKTYAEIFEKFHPIR

Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 subunit C2 Alternative name(s): Complex I-B14.5b Short name= CI-B14.5b NADH-ubiquinone oxidoreductase subunit B14.5b

Gene Names:Name:NDUFC2 ORF Names:QccE-12975

Expression Region:1-119

Sequence Info:full length protein