![Recombinant Macaca fascicularis NADH dehydrogenase [ubiquinone] 1 subunit C2(NDUFC2)](http://cdn.shopify.com/s/files/1/0558/8588/9636/products/no_image_default_image-jpeg_c415dba2-e178-4152-be10-e266db4253df_{width}x.jpg?v=1659246888)
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Uniprot NO.:Q8SPI4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVPRRNPEPLRFLPDESRSLPPPKLTDPRLLYVGFLGYCAGLVDNFIHRRPIRSAGLHRH LLYITAFYFVGYYLVKRGDYTYAVRDREMFGYMKLHPEDFSEKEKKTYAEIFEKFHPIR
Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 subunit C2 Alternative name(s): Complex I-B14.5b Short name= CI-B14.5b NADH-ubiquinone oxidoreductase subunit B14.5b
Gene Names:Name:NDUFC2 ORF Names:QccE-12975
Expression Region:1-119
Sequence Info:full length protein