Skip to product information
1 of 1

Gene Bio Systems

Recombinant Macaca fascicularis Myelin basic protein(EGM_08965)

Recombinant Macaca fascicularis Myelin basic protein(EGM_08965)

SKU:CSB-EP2028MOV

Regular price $1,242.00 USD
Regular price Sale price $1,242.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Neuroscience

Uniprot ID: G7PWA0

Gene Names: EGM_08965

Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

AA Sequence: MGNHAGKRELNTEKASTNGETNRGESEKKTNLGELSRTTSEDSEVFGEADANQNNGTSSQDTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGVPKRGSGKDSHHAARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQKPGFGYGGRASDYKSAHKGFKGVDAQGTLSRIFKLGGRDSRSGSPMARR

Expression Region: 1-304aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 49 kDa

Alternative Name(s):

Relevance:

Reference: "Genome sequencing and comparison of two nonhuman primate animal models, the cynomolgus and Chinese rhesus macaques."Yan G., Zhang G., Fang X., Zhang Y., Li C., Ling F., Cooper D.N., Li Q., Li Y., van Gool A.J., Du H., Chen J., Chen R., Zhang P., Huang Z., Thompson J.R., Meng Y., Bai Y. Wang J.Nat. Biotechnol. 29:1019-1023(2011)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details