Skip to product information
1 of 1

Gene Bio Systems

Recombinant Macaca fascicularis Frataxin, mitochondrial(FXN)

Recombinant Macaca fascicularis Frataxin, mitochondrial(FXN)

SKU:CSB-EP810224MOV

Regular price $1,129.00 USD
Regular price Sale price $1,129.00 USD
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: FXN

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Delivery time: 3-7 business days

Uniprot ID: Q8HXX9

AA Sequence: SGTLGHPGSLDDTTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDRTGKNWVYSHDGVSLHELLGAELTKALKTKLDLSSLAYSGKDA

Tag info: N-terminal 6xHis-tagged

Expression Region: 81-210aa

Protein length: Full Length of Mature Protein

MW: 18.2 kDa

Alternative Name(s):

Relevance: Promotes the biosynthesis of he and assbly and repair of iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe2+ to Fe3+; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Modulates the RNA-binding activity of ACO1 .

Reference: Isolation and characterization of cDNA for macaque neurological disease genes.Kusuda J., Osada N., Hida M., Sugano S., Hashimoto K.

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details