Gene Bio Systems
Recombinant Macaca fascicularis Arachidonate 5-lipoxygenase-activating protein(ALOX5AP)
Recombinant Macaca fascicularis Arachidonate 5-lipoxygenase-activating protein(ALOX5AP)
SKU:CSB-CF001625MOV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Uniprot NO.:Q2PG08
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLLVRQKYFVGYLGERTQSTPGYIFGKRIIL FLFLMSVAGIFNYYLIFFFGSDFENYIKTVTTTISPLLLIP
Protein Names:Recommended name: Arachidonate 5-lipoxygenase-activating protein
Gene Names:Name:ALOX5AP ORF Names:QccE-16217
Expression Region:1-161
Sequence Info:full length protein
