Recombinant Lysinibacillus sphaericus  UPF0295 protein Bsph_0336 (Bsph_0336)

Recombinant Lysinibacillus sphaericus UPF0295 protein Bsph_0336 (Bsph_0336)

CSB-CF534138LRV
Regular price
$1,097.00 USD
Sale price
$1,097.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Lysinibacillus sphaericus (strain C3-41)

Uniprot NO.:B1HUT5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKPYKSKINKIRSFALALIFIGFIVMYGGIFFKNSPILVLIFMTLGVLCIIGSTVVYAWI GLLSTRAIQVECPNCHKHTKVLGRVDMCMYCNEPLTLDPTLEGKEFDQSYNHKTKKS

Protein Names:Recommended name: UPF0295 protein Bsph_0336

Gene Names:Ordered Locus Names:Bsph_0336

Expression Region:1-117

Sequence Info:full length protein