Gene Bio Systems
Recombinant Lithobates catesbeiana Saxiphilin ,partial
Recombinant Lithobates catesbeiana Saxiphilin ,partial
SKU:CSB-BP339158LQA(A5)
Couldn't load pickup availability
Size: 20ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 25-35 working days
Research Topic: Others
Uniprot ID: P31226
Gene Names: N/A
Organism: Lithobates catesbeiana (American bullfrog) (Rana catesbeiana)
AA Sequence: AHLPSKNKVRWCTINKLEKMKCDDWSAVSGGAIACTEASCPKGCVKQILKGEADAVKLEVQYMYEALMCGLLPAVEEYHNKDDFGPCKTPGSPYTDFGTLRAVALVKKSNKDINWNNIKGKKSCHTGVGDIAGWVIPVSLIRRQNDNSDIDSFFGESCAPGSDTKSNLCKLCIGDPKNSAANTKCSLSDKEAYYGNQGAFRCLVEKGDVAFVPHTVVFENTDGKNPAVWAKNLKSEDFELLCLDGSRAPVSNYKSCKLSGIPPPAIVTREESISDVVRIVANQQSLYGRKGFEKDMFQLFSSNKGNNLLFNDNTQCLITFDRQPKDIMEDYFGKPYYTTVYGASRSAMSSELISACTIKHC
Expression Region: 484-844aa
Sequence Info: Partial
Source: Baculovirus
Tag Info: N-terminal 6xHis-tagged
MW: 41.7 kDa
Alternative Name(s): Short name: SAX
Relevance: Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe3+. It may participate in a detoxification mechanism for neutralizing a microbial toxin.
Reference: "Molecular cloning of bullfrog saxiphilin: a unique relative of the transferrin family that binds saxitoxin."Morabito M.A., Moczydlowski E.Proc. Natl. Acad. Sci. U.S.A. 91:2478-2482(1994)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
