Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: E9BTK1
Gene Names: LDBPK_361420
Organism: Leishmania donovani (strain BPK282A1)
AA Sequence: NKLIVEEPYNDDNSVVSLNPKRMEELNIFRGDTVLVKGKKHRSTVCIAMEDDECPPEKIKMNKVARRNIRIHLGDTIRIAPCKD
Expression Region: 15-98aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 13.7 kDa
Alternative Name(s):
Relevance:
Reference: "Whole genome sequencing of Leishmania donovani clinical lines reveals dynamic variation related to drug resistance." Downing T., Imamura H., Sanders M., Decuypere S., Hertz-Fowler C., Clark T.G., Rijal S., Sundar S., Quail M.A., De Doncker S., Maes I., Vanaerschot M., Stark O., Schonian G., Dujardin J.C., Berriman M. Submitted (FEB-2011)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.