Gene Bio Systems
Recombinant Lactococcus lactis subsp. lactis Glycerol-3-phosphate acyltransferase(plsY)
Recombinant Lactococcus lactis subsp. lactis Glycerol-3-phosphate acyltransferase(plsY)
SKU:CSB-CF863314LNG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)
Uniprot NO.:Q9CGW4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLTIILLLIASYLLGAIPFGLWIGKIFFKKNLHDYGSGNTGTTNTFRILGVKAGISVFAF DLLKGTLATLLPLFFHINGVSPLIFGLLAVIGHTFSIFDRFKGGKAVATSAGVILGFSPL FLIYLLVVFIIVLWLFSMISLSSVIGAVFALLGILIFPSIGFILTSYDLLFSIIIFVLAI IIILRHRTNLKRIKNHCESLVPFGLNLSKQKEK
Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase Alternative name(s): Acyl-PO4 G3P acyltransferase Acyl-phosphate--glycerol-3-phosphate acyltransferase G3P acyltransferase Short name= GPAT EC= 2.3.1.n3 Lysophosphati
Gene Names:Name:plsY Synonyms:ykaC Ordered Locus Names:LL0978 ORF Names:L5517
Expression Region:1-213
Sequence Info:full length protein
