Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lactococcus lactis subsp. cremoris UPF0177 protein in abiGi 5'region

Recombinant Lactococcus lactis subsp. cremoris UPF0177 protein in abiGi 5'region

SKU:CSB-CF674154LNF

Regular price $1,908.00 USD
Regular price Sale price $1,908.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Lactococcus lactis subsp. cremoris (Streptococcus cremoris)

Uniprot NO.:Q48724

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIKNHWMKKLKYLSLFFLLFAIYWFPDVILAYPEVYLKSLVGYERQVVATWIFLGNMSIS LFLGILICYKLGYYKNTISIFKIKNLLFLLITTIILFVIYFFSYTYYNSHFITPGIAKTQ AAFSIQIVFPFVQFITIAICAPIFEEASFRTTIYSFFKNDKIAYIVSCVGFAWMHTGPNP ILIVYLPMSIVLTSIYHRRRVLGESILVHGVFNALLPIVIPLLQVITGLYYL

Protein Names:Recommended name: UPF0177 protein in abiGi 5'region Alternative name(s): orfX

Gene Names:

Expression Region:1-232

Sequence Info:full length protein

View full details