Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lactococcus lactis subsp. cremoris Energy-coupling factor transporter transmembrane protein EcfT(ecfT)

Recombinant Lactococcus lactis subsp. cremoris Energy-coupling factor transporter transmembrane protein EcfT(ecfT)

SKU:CSB-CF382283LND

Regular price $1,882.00 USD
Regular price Sale price $1,882.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Lactococcus lactis subsp. cremoris (strain MG1363)

Uniprot NO.:A2RI03

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQNMLMGRYIPGDSIIHRMDPRSKLLVMIAFVVIIFLAHDWLGYLLLVLYTLAGVLLSKI SVSYFLRGLRPMIGLILFTVIFQMLFTNGQHVIFSLWFIKISTESLINAVYIFFRFVLII FMSTILTLTTPPLTLADGIEKGLGPLKKIKVPVHELGLMLSISLRFIPTLMDDTTMIMNA QKARGMDFGEGNLLKKIKSVIPILIPLFVSSFRRADDLAVAMESRGYQGGDGRTKYRQLK WQSRDSLLVVSIIIMTILLILWSKVS

Protein Names:Recommended name: Energy-coupling factor transporter transmembrane protein EcfT Short name= ECF transporter T component EcfT

Gene Names:Name:ecfT Ordered Locus Names:llmg_0289

Expression Region:1-266

Sequence Info:full length protein

View full details