Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lactobacillus plantarum Protein CrcB homolog 2(crcB2)

Recombinant Lactobacillus plantarum Protein CrcB homolog 2(crcB2)

SKU:CSB-CF804539LMS

Regular price $1,713.00 USD
Regular price Sale price $1,713.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)

Uniprot NO.:Q88ZT7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKKIIAITGFAMLGGGLREGLSLLVTWPQHFWITCLINIVGAFVLSLITNLLPARLPVSE DIVIGMSVGFVGSFTTFSTFTFETLQSFQSGHSVLALSYVAASLGLGLLAGLAGNFLSTY WLPKEEF

Protein Names:Recommended name: Protein CrcB homolog 2

Gene Names:Name:crcB2 Ordered Locus Names:lp_0214

Expression Region:1-127

Sequence Info:full length protein

View full details