Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Uniprot NO.:Q74HV9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVKEFKEFISRGNMMDLAVGVIIGAAFTAIVNSLVKDLINPLIGLFIGKIDLSNLKFTIG EATFKYGSFLNAVINFLIIALVVFFLIKLVNKITPKKEVEEDPAPTNEEIYLRQIRDLLQ EKNK
Protein Names:Recommended name: Large-conductance mechanosensitive channel
Gene Names:Name:mscL Ordered Locus Names:LJ_0640
Expression Region:1-124
Sequence Info:full length protein