Gene Bio Systems
Recombinant Lactobacillus delbrueckii subsp. bulgaricus Protein CrcB homolog 2(crcB2)
Recombinant Lactobacillus delbrueckii subsp. bulgaricus Protein CrcB homolog 2(crcB2)
SKU:CSB-CF626502LAQ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081)
Uniprot NO.:Q1GB06
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIFAVGFGASLGAVARYALTSYGKKHWMQGTACPRPTLLINLTGAFFLGLAFALRLPASV YAFLGTGVLGGYTTFSTLNTEMVSLAENGQKHVLKHYLLASYLGGAVLLTCGYYLGSLL
Protein Names:Recommended name: Protein CrcB homolog 2
Gene Names:Name:crcB2 Ordered Locus Names:Ldb0662
Expression Region:1-119
Sequence Info:full length protein
