Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lactobacillus casei UPF0756 membrane protein LCABL_15860 (LCABL_15860)

Recombinant Lactobacillus casei UPF0756 membrane protein LCABL_15860 (LCABL_15860)

SKU:CSB-CF461433LMJ

Regular price $1,744.00 USD
Regular price Sale price $1,744.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Lactobacillus casei (strain BL23)

Uniprot NO.:B3WE66

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MESWLFLLGILAIAIVGKNKSLIIGVSAVMVFKLIPQTQNFLKLLQTQGINWGVTVISAA IMVPIATGEIGFKELLNVIKSPAGWIAIGCGVLVAVLSAKGVGLLAMSPEMTVALVFGTI IGVVFLKGIAAGPVIASGLTYVILTVFNLVPGH

Protein Names:Recommended name: UPF0756 membrane protein LCABL_15860

Gene Names:Ordered Locus Names:LCABL_15860

Expression Region:1-153

Sequence Info:full length protein

View full details