Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Uniprot NO.:Q5FKD1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNFLLAGIGASIGAMLRYAITNYGKKHWEWIGNKFSNLPTPTLFINLTGAFILGFIFGIK TNVFIYAIVGTGVLGGYTTFSTMNTELVELYKSKNYRGFIFYALSSYLGGLILVFVGYYL AILF
Protein Names:Recommended name: Protein CrcB homolog 2
Gene Names:Name:crcB2 Ordered Locus Names:LBA0993
Expression Region:1-124
Sequence Info:full length protein