Skip to product information
1 of 1

Gene Bio Systems

Recombinant Kluyveromyces lactis pH-response regulator palI-RIM9 homolog 1(KLLA0A04389g)

Recombinant Kluyveromyces lactis pH-response regulator palI-RIM9 homolog 1(KLLA0A04389g)

SKU:CSB-CF721744KBK

Regular price $1,827.00 USD
Regular price Sale price $1,827.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)

Uniprot NO.:Q6CXZ7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSHFKIVFLTSLSLALVFELFNTISVPITSHLFISEYNGYKFGVFGWCKVDGSICSPIRM GYSLDDILLFNDNEYLHLPNHAKYALSKLLLVHVLSFVCVLVFWLFAILICIKWLNTSKS VLLFAVGWSMVTFMVSLLGFLIDVLMFASHVTWSSWLMLVSAFFVALSGILLCLMIRDLS YRRFVKLQGEVDVCVPMTEPRDPDELNEIWKKKTSKREIL

Protein Names:Recommended name: pH-response regulator palI/RIM9 homolog 1

Gene Names:Ordered Locus Names:KLLA0A04389g

Expression Region:1-220

Sequence Info:full length protein

View full details