Gene Bio Systems
Recombinant Klebsiella pneumoniae Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF(arnF)
Recombinant Klebsiella pneumoniae Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF(arnF)
SKU:CSB-CF481021KBH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Klebsiella pneumoniae (strain 342)
Uniprot NO.:B5XTL3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGFLWALFSVGLVSAAQLLLRSAMVALPPLTDIVAFLQHLLHFQPGTVGLFFGLLGYLLS MVCWYFALHRLPLSKAYALLSLSYILVWAAAIWLPGWHEPFYWQSLLGVTIIVAGVLTIF WPVKRR
Protein Names:Recommended name: Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Short name= L-Ara4N-phosphoundecaprenol flippase subunit ArnF Alternative name(s): Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Gene Names:Name:arnF Ordered Locus Names:KPK_0273
Expression Region:1-126
Sequence Info:full length protein
