Skip to product information
1 of 1

Gene Bio Systems

Recombinant Klebsiella pneumoniae Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE(arnE)

Recombinant Klebsiella pneumoniae Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE(arnE)

SKU:CSB-CF466644KBH

Regular price $1,538.00 USD
Regular price Sale price $1,538.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Klebsiella pneumoniae (strain 342)

Uniprot NO.:B5XTL2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSVWICLVFASLLSCAGQLCQKQATRPSRRGRRSRHILFWLGMALLCLGCGMLLWLSVLQ SIPVSIAYPMLSLNFVWVTLAGWGIWHEPVARRHWLGVGLIVVGIVILGTSV

Protein Names:Recommended name: Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Short name= L-Ara4N-phosphoundecaprenol flippase subunit ArnE Alternative name(s): Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE

Gene Names:Name:arnE Ordered Locus Names:KPK_0271

Expression Region:1-112

Sequence Info:full length protein

View full details