Skip to product information
1 of 1

GeneBio Systems

Recombinant Klebsiella pneumoniae Phosphoethanolamine--lipid A transferase MCR-8.1 (mcr-8), partial

Recombinant Klebsiella pneumoniae Phosphoethanolamine--lipid A transferase MCR-8.1 (mcr-8), partial

SKU:A0A2U7XX87

Regular price $1,068.00 USD
Regular price Sale price $1,068.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: A0A2U7XX87

Gene Names: mcr-8

Alternative Name(s):

Abbreviation: Recombinant Klebsiella pneumoniae mcr-8 protein, partial

Organism: Klebsiella pneumoniae

Source: E.coli

Expression Region: 177-565aa

Protein Length: partial

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: KDYASLIRNNMQIKDQALPFNFVRNTNGYLKRKYQASSTILQSVGEDAVRPIYSNAPPKLVVVVVGETARAQNFQLNGYSRVTNPYLSRRHDVISFKNVSSCGTATAISLPCMFSRMSRNEYNEVRAASEENLLDILKRTGVEVLWRNNNNGGCKGICKRVPTDDMPAMKVIGECVNKDGTCFDEVLLNQLSSRINAMQGDALIVLHQMGSHGPTYFERYPSTSKVFSPTCDSNLIEKCSNKELVNTYDNTLVYTDRMLSKTIELLQRYSGMRDVAMIYLSDHGESLGESGIYLHGTPYIIAPNEQTHIPMFMWFSSSFAQHSKLNLECLTGNADKQYSHDNFYHSILGLFNVKTSVYKPELDMFTLCRQSDHTPLSSAVVREKTDGNG

MW: 46.0 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Induces apoptosis and anoikis. Isoform BimL is more potent than isoform BimEL. Isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3 induce apoptosis, although less potent than isoform BimEL, isoform BimL and isoform BimS. Isoform Bim-gamma induces apoptosis. Isoform Bim-alpha3 induces apoptosis possibly through a caspase-mediated pathway. Isoform BimAC and isoform BimABC lack the ability to induce apoptosis.

Reference: Identification and characterization of BH3 domain protein Bim and its isoforms in human hepatocellular carcinomas.Miao J., Chen G.G., Yun J.P., Chun S.Y., Zheng Z.Z., Ho R.L.K., Chak E.C., Xia N.S., Lai P.B.Apoptosis 12: 1691-1701(2007)

Function:

View full details