Skip to product information
1 of 1

Gene Bio Systems

Recombinant Klebsiella oxytoca Carbepenem-hydrolyzing beta-lactamase KPC(bla)

Recombinant Klebsiella oxytoca Carbepenem-hydrolyzing beta-lactamase KPC(bla)

SKU:CSB-EP802889KBE

Regular price $1,244.00 USD
Regular price Sale price $1,244.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: Q848S6

Gene Names: bla

Organism: Klebsiella oxytoca

AA Sequence: LTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGVNGQ

Expression Region: 25-293aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 44.5 kDa

Alternative Name(s): Carbapenem-hydrolyzing beta-lactamase KPC-2

Relevance: Hydrolyzes carbapenems, penicillins, cephalosporins and aztreonam with varying efficiency.

Reference: "Carbapenem-resistant strain of Klebsiella oxytoca harboring carbapenem-hydrolyzing beta-lactamase KPC-2."Yigit H., Queenan A.M., Rasheed J.K., Biddle J.W., Domenech-Sanchez A., Alberti S., Bush K., Tenover F.C.Antimicrob. Agents Chemother. 47:3881-3889(2003)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details