Gene Bio Systems
Recombinant Ixodes scapularis UPF0608 protein ISCW013552 (ISCW013552)
Recombinant Ixodes scapularis UPF0608 protein ISCW013552 (ISCW013552)
SKU:CSB-CF488115INM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Ixodes scapularis (Black-legged tick) (Deer tick)
Uniprot NO.:B7QIN3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MISDIILFGTLMVNAGAVLNFKLQKTPSESFVEKTEPTAGDKIRDFLGAVRYFRAFIGLW NIFIMFLMLVFFGS
Protein Names:Recommended name: UPF0608 protein ISCW013552
Gene Names:ORF Names:ISCW013552
Expression Region:1-74
Sequence Info:full length protein