Skip to product information
1 of 1

Gene Bio Systems

Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 135R(IIV6-135R)

Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 135R(IIV6-135R)

SKU:CSB-CF838659INA

Regular price $1,647.00 USD
Regular price Sale price $1,647.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Invertebrate iridescent virus 6 (IIV-6) (Chilo iridescent virus)

Uniprot NO.:Q91G04

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTKFTFSRFVIFSLFFTFISVSTFGNINFRFIVCKWTIFSFVALFYIFTHTSFTSLCFFG LRLFWHFFPRM

Protein Names:Recommended name: Uncharacterized protein 135R

Gene Names:ORF Names:IIV6-135R

Expression Region:1-71

Sequence Info:full length protein

View full details