
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Invertebrate iridescent virus 6 (IIV-6) (Chilo iridescent virus)
Uniprot NO.:Q91G84
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNNFNYFNGKMVEDILENPDEDILNPDKSKTKDIVIKEDFCGACLALPLAFAGAGTATAT SGDTSGNKSKSSIFFWSVVISIIGLIATVWFLSGDCTTCVSEGNSRGKRTGSMVCSSTRR
Protein Names:Recommended name: Transmembrane protein 010R
Gene Names:ORF Names:IIV6-010R
Expression Region:1-120
Sequence Info:full length protein