Recombinant Invertebrate iridescent virus 6  Transmembrane protein 010R(IIV6-010R)

Recombinant Invertebrate iridescent virus 6 Transmembrane protein 010R(IIV6-010R)

CSB-CF852759INA
Regular price
$1,103.00 USD
Sale price
$1,103.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Invertebrate iridescent virus 6 (IIV-6) (Chilo iridescent virus)

Uniprot NO.:Q91G84

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNNFNYFNGKMVEDILENPDEDILNPDKSKTKDIVIKEDFCGACLALPLAFAGAGTATAT SGDTSGNKSKSSIFFWSVVISIIGLIATVWFLSGDCTTCVSEGNSRGKRTGSMVCSSTRR

Protein Names:Recommended name: Transmembrane protein 010R

Gene Names:ORF Names:IIV6-010R

Expression Region:1-120

Sequence Info:full length protein