Skip to product information
1 of 1

Gene Bio Systems

Recombinant Inner membrane protein YqjA(yqjA)

Recombinant Inner membrane protein YqjA(yqjA)

SKU:CSB-CF359408SZB

Regular price $1,825.00 USD
Regular price Sale price $1,825.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Shigella flexneri

Uniprot NO.:P0AA66

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MELLTQLLQALWAQDFETLANPSMIGMLYFVLFVILFLENGLLPAAFLPGDSLLVLVGVL IAKGAMGYPQTILLLTVAASLGCWVSYIQGRWLGNTRTVQNWLSHLPAHYHQRAHHLFHK HGLSALLIGRFIAFVRTLLPTIAGLSGLNNARFQFFNWMSGLLWVLILTTLGYMLGKTPV FLKYEDQLMSCLMLLPVVLLVFGLAGSLVVLWKKKYGNRG

Protein Names:Recommended name: Inner membrane protein YqjA

Gene Names:Name:yqjA Ordered Locus Names:SF3138, S3346

Expression Region:1-220

Sequence Info:full length protein

View full details