Skip to product information
1 of 1

Gene Bio Systems

Recombinant Hyperthermus butylicus UPF0290 protein Hbut_1639 (Hbut_1639)

Recombinant Hyperthermus butylicus UPF0290 protein Hbut_1639 (Hbut_1639)

SKU:CSB-CF382402HSR

Regular price $1,764.00 USD
Regular price Sale price $1,764.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Hyperthermus butylicus (strain DSM 5456 / JCM 9403)

Uniprot NO.:A2BN92

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAQLLTPLESILAIIPALAANGAPVLLKYHGTPIDGGKRFLDGRPVLGPGKTWEGLATGI LYGSVIALLAASATCNPKLYAAGVFASIGAMLGDMLGAFIKRRLGLERGAPAPLLDQLDF YSGALLALYAAGYVVHPAVALTFTPIVIALHRLTNMAANRLRLKPVPW

Protein Names:Recommended name: UPF0290 protein Hbut_1639

Gene Names:Ordered Locus Names:Hbut_1639

Expression Region:1-168

Sequence Info:full length protein

View full details