
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Hydrogenobaculum sp. (strain Y04AAS1)
Uniprot NO.:B4U8V5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKLKTLMLLTLASSIAMADTASSSSSDAHARALFYGLMAVAAGVSIGLGALGAGVGAGSA IRGAEEGMARNPNMAGKLQTIMFIGLAFIETFALYAMLFSIIFVFTGIFSGKAGF
Protein Names:Recommended name: ATP synthase subunit c Alternative name(s): ATP synthase F(0) sector subunit c F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein
Gene Names:Name:atpE Ordered Locus Names:HY04AAS1_0879
Expression Region:1-115
Sequence Info:full length protein
You may also like
-
Recombinant Sulfurihydrogenibium sp. ATP synthase subunit c(atpE)
- Regular price
- $1,549.00 USD
- Sale price
- $1,549.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Geobacillus sp. ATP synthase subunit c(atpE)
- Regular price
- $1,500.00 USD
- Sale price
- $1,500.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Acinetobacter sp. ATP synthase subunit c(atpE)
- Regular price
- $1,512.00 USD
- Sale price
- $1,512.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant ATP synthase subunit c(atpE)
- Regular price
- $1,517.00 USD
- Sale price
- $1,517.00 USD
- Regular price
-
- Unit price
- per
Sold out