Skip to product information
1 of 1

Gene Bio Systems

Recombinant Huperzia lucidula ATP synthase subunit c, chloroplastic(atpH)

Recombinant Huperzia lucidula ATP synthase subunit c, chloroplastic(atpH)

SKU:CSB-CF729141HCAC

Regular price $1,706.00 USD
Regular price Sale price $1,706.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Huperzia lucidula (Shining clubmoss) (Lycopodium lucidulum)

Uniprot NO.:Q5SCX4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALPFANPFV

Protein Names:Recommended name: ATP synthase subunit c, chloroplastic Alternative name(s): ATP synthase F(0) sector subunit c ATPase subunit III F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein

Gene Names:Name:atpH

Expression Region:1-81

Sequence Info:full length protein

View full details