
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Transcription
Uniprot ID: P19544
Gene Names: WT1
Organism: Homo sapiens (Human)
AA Sequence: MEKGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRIHTHGVFRGIQDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQ
Expression Region: 1-299aa
Sequence Info: Partial of Isoform 6
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 38.2 kDa
Alternative Name(s): WT33
Relevance: Transcription factor that plays an important role in cellular development and cell survival. Regulates the expression of numerous target genes, including EPO. Plays an essential role for development of the urogenital syst. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3'. It has a tumor suppressor as well as an oncogenic role in tumor formation. Function may be isoform-specific: isoforms lacking the KTS motif may act as transcription factors. Isoforms containing the KTS motif may bind mRNA and play a role in mRNA metabolism or splicing. Isoform 1 has lower affinity for DNA, and can bind RNA.
Reference: Homozygous deletion in Wilms tumours of a zinc-finger gene identified by chromosome jumping.Gessler M., Poustka A., Cavenee W., Neve R.L., Orkin S.H., Bruns G.A.P.Nature 343:774-778(1990)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Wilms tumor protein(WT1)
- Regular price
- $758.00 USD
- Sale price
- $758.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Wilms tumor protein(WT1)
- Regular price
- $847.00 USD
- Sale price
- $847.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human DNA-binding protein Ikaros(IKZF1)
- Regular price
- $728.00 USD
- Sale price
- $728.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Wilms tumor protein homolog(Wt1)
- Regular price
- $896.00 USD
- Sale price
- $896.00 USD
- Regular price
-
- Unit price
- per
Sold out