Recombinant Human Vitamin D-binding protein(GC),partial

Recombinant Human Vitamin D-binding protein(GC),partial

CSB-YP009306HU
Regular price
$529.00 USD
Sale price
$529.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171018

Research areas: Signal Transduction

Target / Protein: GC

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: P02774

AA Sequence: RGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL

Tag info: N-terminal 6xHis-sumostar-tagged

Expression Region: 19-474aa

Protein length: Partial of NM_000583.3

MW: 67 kDa

Alternative Name(s): Gc protein-derived macrophage activating factor

Relevance: Involved in vitamin D transport and storage, scavenging of extracellular G-actin, enhancement of the chemotactic activity of C5 alpha for neutrophils in inflammation and macrophage activation.

Reference: "Serum vitamin D-binding protein is a third member of the albumin and alpha fetoprotein gene family." Cooke N.E., David E.V. J. Clin. Invest. 76:2420-2424(1985)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share