Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Vesicle transport protein GOT1A(GOLT1A)

Recombinant Human Vesicle transport protein GOT1A(GOLT1A)

SKU:CSB-CF751192HU

Regular price $1,719.00 USD
Regular price Sale price $1,719.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q6ZVE7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MISITEWQKIGVGITGFGIFFILFGTLLYFDSVLLAFGNLLFLTGLSLIIGLRKTFWFFF QRHKLKGTSFLLGGVVIVLLRWPLLGMFLETYGFFSLFKGFFPVAFGFLGNVCNIPFLGA LFRRLQGTSSMV

Protein Names:Recommended name: Vesicle transport protein GOT1A Alternative name(s): Golgi transport 1 homolog A hGOT1b

Gene Names:Name:GOLT1A Synonyms:GOT1B

Expression Region:1-132

Sequence Info:full length protein

View full details