Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Vesicle-associated membrane protein 5(VAMP5)

Recombinant Human Vesicle-associated membrane protein 5(VAMP5)

SKU:CSB-CF025784HU

Regular price $1,699.00 USD
Regular price Sale price $1,699.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O95183

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN

Protein Names:Recommended name: Vesicle-associated membrane protein 5 Short name= VAMP-5 Alternative name(s): Myobrevin

Gene Names:Name:VAMP5 ORF Names:HSPC191

Expression Region:1-116

Sequence Info:full length protein

View full details