Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human UPF0466 protein C22orf32, mitochondrial(C22orf32)

Recombinant Human UPF0466 protein C22orf32, mitochondrial(C22orf32)

SKU:CSB-CF880975HU

Regular price $1,633.00 USD
Regular price Sale price $1,633.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9H4I9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VIVTRSGAILPKPVKMSFGLLRVFSIVIPFLYVGTLISKNFAALLEEHDIFVPEDDDDDD

Protein Names:Recommended name: UPF0466 protein C22orf32, mitochondrial

Gene Names:Name:C22orf32

Expression Region:48-107

Sequence Info:full length protein

View full details