Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human UDP-glucuronosyltransferase 2B7(UGT2B7)

Recombinant Human UDP-glucuronosyltransferase 2B7(UGT2B7)

SKU:CSB-CF025598HU

Regular price $2,241.00 USD
Regular price Sale price $2,241.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P16662

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GKVLVWAAEYSHWMNIKTILDELIQRGHEVTVLASSASILFDPNNSSALKIEIYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFGDITRKFCKDVVSNKKFMKKVQESRFDVIFADAIFPCSELLAELFNIPFVYSLSFSPGYTFEKHSGGFIFPPSYVPVVMSELTDQMTFMERVKNMIYVLYFDFWFEIFDMKKWDQFYSEVLGRPTTLSETMGKADVWLIRNSWNFQFPHPLLPNVDFVGGLHCKPAKPLPKEMEDFVQSSGENGVVVFSLGSMVSNMTEERANVIASALAQIPQKVLWRFDGNKPDTLGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDFNTMSSTDLLNALKRVINDPSYKENVMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLDVIGFLLVCVATVIFIVTKCCLFCFWKFARKAKKGKND

Protein Names:Recommended name: UDP-glucuronosyltransferase 2B7 Short name= UDPGT 2B7 EC= 2.4.1.17Alternative name(s): 3,4-catechol estrogen-specific UDPGT UDP-glucuronosyltransferase 2B9 Short name= UDPGT 2B9 UDPGTh-2

Gene Names:Name:UGT2B7Synonyms:UGTB2B9

Expression Region:24-529

Sequence Info:full length protein

View full details