Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Tumor necrosis factor receptor superfamily member 5(CD40)

Recombinant Human Tumor necrosis factor receptor superfamily member 5(CD40)

SKU:CSB-CF004936HU

Regular price $1,929.00 USD
Regular price Sale price $1,929.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P25942

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ

Protein Names:Recommended name: Tumor necrosis factor receptor superfamily member 5 Alternative name(s): B-cell surface antigen CD40 Bp50 CD40L receptor CDw40 CD_antigen= CD40

Gene Names:Name:CD40 Synonyms:TNFRSF5

Expression Region:21-277

Sequence Info:full length protein

View full details