Recombinant Human Tumor necrosis factor ligand superfamily member 9(TNFSF9),partial (Active)

Recombinant Human Tumor necrosis factor ligand superfamily member 9(TNFSF9),partial (Active)

CSB-MP023997HU1
Regular price
$347.00 USD
Sale price
$347.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Cancer

Uniprot NO.:P41273

Uniprot Entry Name:

Gene Names:TNFSF9

Species:Homo sapiens (Human)

Source:Mammalian cell

Expression Region:71-254aa

Sequence:REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Protein Description:Partial

Tag Info:N-terminal hFc-Myc-tagged

Mol. Weight:48.0 kDa

Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized TNFSF9 at 2 ?g/mL can bind TNFRSF9?CSB-MP023984HU1?, the EC50 is 2.671-3.702 ng/mL.

Purity:Greater than 90% as determined by SDS-PAGE.

Endotoxin:Less than 1.0 EU/ug as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:(4-1BB ligand) (4-1BBL)

Relevance:Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages.

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Your list is ready to share