Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Tumor necrosis factor ligand superfamily member 4(TNFSF4)

Recombinant Human Tumor necrosis factor ligand superfamily member 4(TNFSF4)

SKU:CSB-CF023994HU

Regular price $1,783.00 USD
Regular price Sale price $1,783.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P23510

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

Protein Names:Recommended name: Tumor necrosis factor ligand superfamily member 4 Alternative name(s): Glycoprotein Gp34 OX40 ligand Short name= OX40L TAX transcriptionally-activated glycoprotein 1 CD_antigen= CD252

Gene Names:Name:TNFSF4 Synonyms:TXGP1

Expression Region:1-183

Sequence Info:full length protein

View full details