Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Transmembrane protein C9orf71(C9orf71)

Recombinant Human Transmembrane protein C9orf71(C9orf71)

SKU:CSB-CF836678HU

Regular price $1,765.00 USD
Regular price Sale price $1,765.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q8N6L7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQNRTGLILCALALLMGFLMVCLGAFFISWGSIFDCQGSLIAAYLLLPLGFVILLSGIFW SNYRQVTESKGVLRHMLRQHLAHGALPVATVDRPDFYPPAYEESLEVEKQSCPAEREASG IPPPLYTETGLEFQDGNDSHPEAPPSYRESIAGLVVTAISEDAQRRGQEC

Protein Names:Recommended name: Transmembrane protein C9orf71

Gene Names:Name:C9orf71

Expression Region:1-170

Sequence Info:full length protein

View full details