Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Transmembrane protein 85(TMEM85)

Recombinant Human Transmembrane protein 85(TMEM85)

SKU:CSB-CF023887HU

Regular price $1,781.00 USD
Regular price Sale price $1,781.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q5J8M3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTAQGGLVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQET DRILVEKRCWDIALGPLKQIPMNLFIMYMAGNTISIFPTMMVCMMAWRPIQALMAISATF KMLESSSQKFLQGLVYLIGNLMGLALAVYKCQSMGLLPTHASDWLAFIEPPERMEFSGGG LLL

Protein Names:Recommended name: Transmembrane protein 85 Alternative name(s): Cell proliferation-inducing gene 17 protein

Gene Names:Name:TMEM85 ORF Names:HSPC184, PIG17

Expression Region:1-183

Sequence Info:full length protein

View full details