Gene Bio Systems
Recombinant Human Transmembrane protein 50B(TMEM50B)
Recombinant Human Transmembrane protein 50B(TMEM50B)
SKU:CSB-CF023850HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:P56557
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAGFLDNFRWPECECIDWSERRNAVASVVAGILFFTGWWIMIDAAVVYPKPEQLNHAFHT CGVFSTLAFFMINAVSNAQVRGDSYESGCLGRTGARVWLFIGFMLMFGSLIASMWILFGA YVTQNTDVYPGLAVFFQNALIFFSTLIYKFGRTEELWT
Protein Names:Recommended name: Transmembrane protein 50B Alternative name(s): HCV p7-trans-regulated protein 3
Gene Names:Name:TMEM50B Synonyms:C21orf4 ORF Names:UNQ167/PRO193
Expression Region:1-158
Sequence Info:Full length protein
