Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Transmembrane protease serine 3(TMPRSS3)

Recombinant Human Transmembrane protease serine 3(TMPRSS3)

SKU:CSB-CF023925HU

Regular price $2,173.00 USD
Regular price Sale price $2,173.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P57727

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFPIIVIGIIALILALAIGLGIHFDCSGKYRCRSSFKCIELIARCDGVSDCKDGEDEYRCVRVGGQNAVLQVFTAASWKTMCSDDWKGHYANVACAQLGFPSYVSSDNLRVSSLEGQFREEFVSIDHLLPDDKVTALHHSVYVREGCASGHVVTLQCTACGHRRGYSSRIVGGNMSLLSQWPWQASLQFQGYHLCGGSVITPLWIITAAHCVYDLYLPKSWTIQVGLVSLLDNPAPSHLVEKIVYHSKYKPKRLGNDIALMKLAGPLTFNEMIQPVCLPNSEENFPDGKVCWTSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLTGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRVTSFLDWIHEQMERDLKT

Protein Names:Recommended name: Transmembrane protease serine 3 EC= 3.4.21.- Alternative name(s): Serine protease TADG-12 Tumor-associated differentially-expressed gene 12 protein

Gene Names:Name:TMPRSS3 Synonyms:ECHOS1, TADG12 ORF Names:UNQ323/PRO382

Expression Region:1-454

Sequence Info:full length protein

View full details