Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Translocon-associated protein subunit beta(SSR2)

Recombinant Human Translocon-associated protein subunit beta(SSR2)

SKU:CSB-CF022718HU

Regular price $1,814.00 USD
Regular price Sale price $1,814.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P43308

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:EEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDTPKTKKN

Protein Names:Recommended name: Translocon-associated protein subunit beta Short name= TRAP-beta Alternative name(s): Signal sequence receptor subunit beta Short name= SSR-beta

Gene Names:Name:SSR2 Synonyms:TRAPB ORF Names:HSD25

Expression Region:18-183

Sequence Info:full length protein

View full details