Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human TM2 domain-containing protein 3(TM2D3)

Recombinant Human TM2 domain-containing protein 3(TM2D3)

SKU:CSB-CF863106HU

Regular price $1,825.00 USD
Regular price Sale price $1,825.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9BRN9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GEQSQALAQSIKDPGPTRTFTVVPRAAESTEIPPYVMKCPSNGLCSRLPADCIDCTTNFS CTYGKPVTFDCAVKPSVTCVDQDFKSQKNFIINMTCRFCWQLPETDYECTNSTSCMTVSC PRQRYPANCTVRDHVHCLGNRTFPKMLYCNWTGGYKWSTALALSITLGGFGADRFYLGQW REGLGKLFSFGGLGIWTLIDVLLIGVGYVGPADGSLYI

Protein Names:Recommended name: TM2 domain-containing protein 3 Alternative name(s): Beta-amyloid-binding protein-like protein 2 Short name= BBP-like protein 2

Gene Names:Name:TM2D3 Synonyms:BLP2

Expression Region:30-247

Sequence Info:full length protein

View full details