
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Immunology
Target / Protein: CD8A
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: P01732
AA Sequence: SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
Tag info: N-terminal 6xHis-tagged
Expression Region: 22-182aa
Protein length: Extracellular Domain
MW: 19.6 kDa
Alternative Name(s): T-lymphocyte differentiation antigen T8/Leu-2 CD_antigen: CD8a
Relevance: Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains.
Reference: "The isolation and sequence of the gene encoding T8: a molecule defining functional classes of T lymphocytes."Littman D.R., Thomas Y., Maddon P.J., Chess L., Axel R.Cell 40:237-246(1985)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human T-cell surface glycoprotein CD8 alpha chain(CD8A),partial
- Regular price
- $848.00 USD
- Sale price
- $848.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human T-cell surface glycoprotein CD8 alpha chain(CD8A),partial
- Regular price
- $760.00 USD
- Sale price
- $760.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain(CD8A),partial
- Regular price
- $1,253.00 USD
- Sale price
- $1,253.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain(CD8A),partial
- Regular price
- $1,142.00 USD
- Sale price
- $1,142.00 USD
- Regular price
-
- Unit price
- per
Sold out