Gene Bio Systems
Recombinant Human T-cell leukemia virus 1 Accessory protein p12I
Recombinant Human T-cell leukemia virus 1 Accessory protein p12I
SKU:CSB-CF366266HQJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Human T-cell leukemia virus 1 (strain Japan ATK-1 subtype A) (HTLV-1)
Uniprot NO.:P0C215
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLFRLLSPLSPLALTALLLFLLPPSDVSGLLLRPPPAPCLLLFLPFQILSGLLFLLFLPL FFSLPLLLSPSLPITMRFPARWRFLPWKAPSQPAAAFLF
Protein Names:Recommended name: Accessory protein p12I
Gene Names:
Expression Region:1-99
Sequence Info:full length protein
